Lineage for d2nsya_ (2nsy A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) 
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (3 proteins) Protein NH3-dependent NAD+-synthetase [52406] (1 species) Species Bacillus subtilis [TaxId:1423] [52407] (2 PDB entries) 
Domain d2nsya_: 2nsy A: [31612]
Details for d2nsya_
PDB Entry: 2nsy (more details), 2 Å
PDB Description: crystal structure of nh3-dependent nad+ synthetase from bacillus subtilis in complex with nad-adenylate
SCOP Domain Sequences for d2nsya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nsya_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk
SCOP Domain Coordinates for d2nsya_:
Click to download the PDB-style file with coordinates for d2nsya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nsya_:
- d2nsya_ appears in SCOP 1.57
- d2nsya_ appears in the current release, SCOPe 2.08
View in 3D
