Lineage for d5ebwc_ (5ebw C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577083Protein Potassium channel protein [56901] (3 species)
  7. 2577123Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)
  8. 2577136Domain d5ebwc_: 5ebw C: [316114]
    Other proteins in same PDB: d5ebwb1, d5ebwb2
    automated match to d1r3jc_
    complexed with dga, f09, k; mutant

Details for d5ebwc_

PDB Entry: 5ebw (more details), 2.3 Å

PDB Description: kcsa with g77ester mutation
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d5ebwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ebwc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
hgsalhwraagaatvllvivllagsylavlaergapgaqlitypralwwacetattvxyg
dlypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqer

SCOPe Domain Coordinates for d5ebwc_:

Click to download the PDB-style file with coordinates for d5ebwc_.
(The format of our PDB-style files is described here.)

Timeline for d5ebwc_: