SCOPe 2.08: Domain d5ebwb2: 5ebw B:108-210

Lineage for d5ebwb2 (5ebw B:108-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5ebwb2: 5ebw B:108-210 [316104]
   Other proteins in same PDB: d5ebwa1, d5ebwa2, d5ebwb1, d5ebwc_
   automated match to d4h88l2
   complexed with dga, f09, k; mutant

Details for d5ebwb2

PDB Entry: 5ebw, 2.3 Å

PDB Description: kcsa with g77ester mutation

PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d5ebwb2:

Sequence; same for both SEQRES and ATOM records:

>d5ebwb2 b.1.1.2 (B:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Timeline for d5ebwb2:

• d5ebwb2 first appeared in SCOPe 2.06
  
• d5ebwb2 appears in SCOPe 2.07