![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d5ebwb1: 5ebw B:1-107 [316103] Other proteins in same PDB: d5ebwa1, d5ebwa2, d5ebwb2, d5ebwc_ automated match to d4h88l1 complexed with dga, f09, k; mutant |
PDB Entry: 5ebw (more details), 2.3 Å
SCOPe Domain Sequences for d5ebwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ebwb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik
Timeline for d5ebwb1: