Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein GMP synthetase, central domain [52404] (2 species) |
Species Escherichia coli [TaxId:562] [52405] (1 PDB entry) |
Domain d1gpma1: 1gpm A:208-404 [31608] Other proteins in same PDB: d1gpma2, d1gpma3, d1gpmb2, d1gpmb3, d1gpmc2, d1gpmc3, d1gpmd2, d1gpmd3 complexed with amp, cit, mg, po4, pop |
PDB Entry: 1gpm (more details), 2.2 Å
SCOPe Domain Sequences for d1gpma1:
Sequence, based on SEQRES records: (download)
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle dvkwlaqgtiypdviesaasatgkahvikshhnvgglpkemkmglveplkelfkdevrki glelglpydmlyrhpfp
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} wtpakiiddavarireqvgddkvilglsggvdssvtamllhraigknltcvfvdngllrl neaeqvldmfgdhfglnivhvpaedrflsalagendpeakrkiigrvfvevfdeealkle dvkwlaqgtiypdviesaakmglveplkelfkdevrkiglelglpydmlyrhpfp
Timeline for d1gpma1: