Lineage for d5e0tb2 (5e0t B:127-259)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2216175Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2216176Protein automated matches [226907] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [254935] (3 PDB entries)
  8. 2216295Domain d5e0tb2: 5e0t B:127-259 [316070]
    automated match to d1plqa2
    mutant

Details for d5e0tb2

PDB Entry: 5e0t (more details), 2.67 Å

PDB Description: human pcna mutant - s228i
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5e0tb2:

Sequence, based on SEQRES records: (download)

>d5e0tb2 d.131.1.0 (B:127-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlimsadvplvveykiadmgh
lkyylapkiedee

Sequence, based on observed residues (ATOM records): (download)

>d5e0tb2 d.131.1.0 (B:127-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqte
eavtiemnepvqltfalrylnfftkatplsstvtlimsadvplvveykiadmghlkyyla
pkiedee

SCOPe Domain Coordinates for d5e0tb2:

Click to download the PDB-style file with coordinates for d5e0tb2.
(The format of our PDB-style files is described here.)

Timeline for d5e0tb2: