SCOPe 2.06: Domain d5e0tc1: 5e0t C:1-126

Lineage for d5e0tc1 (5e0t C:1-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254935] (3 PDB entries)

8. Domain d5e0tc1: 5e0t C:1-126 [316066]
   automated match to d1plqa1
   mutant

Details for d5e0tc1

PDB Entry: 5e0t, 2.67 Å

PDB Description: human pcna mutant - s228i

PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5e0tc1:

Sequence; same for both SEQRES and ATOM records:

>d5e0tc1 d.131.1.0 (C:1-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

Timeline for d5e0tc1:

• d5e0tc1 is new in SCOPe 2.06-stable
  
• d5e0tc1 appears in SCOPe 2.07
  
• d5e0tc1 appears in the current release, SCOPe 2.08