SCOPe 2.06: Domain d5e0ta2: 5e0t A:127-255

Lineage for d5e0ta2 (5e0t A:127-255)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254935] (3 PDB entries)

8. Domain d5e0ta2: 5e0t A:127-255 [316065]
   automated match to d1plqa2
   mutant

Details for d5e0ta2

PDB Entry: 5e0t, 2.67 Å

PDB Description: human pcna mutant - s228i

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5e0ta2:

Sequence, based on SEQRES records:

>d5e0ta2 d.131.1.0 (A:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlimsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records):

>d5e0ta2 d.131.1.0 (A:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqte
avtiemnepvqltfalrylnfftkatplsstvtlimsadvplvveykiadmghlkyylap
ki

Timeline for d5e0ta2:

• d5e0ta2 is new in SCOPe 2.06-stable
  
• d5e0ta2 appears in SCOPe 2.07
  
• d5e0ta2 appears in the current release, SCOPe 2.08