SCOPe 2.06: Domain d1f9ae_: 1f9a E:

Lineage for d1f9ae_ (1f9a E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)

7. Species Methanococcus jannaschii [TaxId:2190] [52401] (1 PDB entry)

8. Domain d1f9ae_: 1f9a E: [31606]
   complexed with atp, mg

Details for d1f9ae_

PDB Entry: 1f9a, 2 Å

PDB Description: crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii

PDB Compounds: (E:) hypothetical protein mj0541

SCOPe Domain Sequences for d1f9ae_:

Sequence; same for both SEQRES and ATOM records:

>d1f9ae_ c.26.1.3 (E:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanococcus jannaschii [TaxId: 2190]}
lrgfiigrfqpfhkghlevikkiaeevdeiiigigsaqkshtlenpftagerilmitqsl
kdydltyypipikdiefnsiwvsyvesltppfdivysgnplvrvlfeergyevkrpemfn
rkeysgteirrrmlngekwehlvpkavvdvikeikgverlrkla

Timeline for d1f9ae_:

• d1f9ae_ first appeared (with stable ids) in SCOP 1.55
  
• d1f9ae_ appears in SCOPe 2.05
  
• d1f9ae_ appears in SCOPe 2.07
  
• d1f9ae_ appears in the current release, SCOPe 2.08