Lineage for d5eblc_ (5ebl C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577060Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2577061Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2577062Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2577083Protein Potassium channel protein [56901] (3 species)
  7. 2577123Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)
  8. 2577134Domain d5eblc_: 5ebl C: [316056]
    Other proteins in same PDB: d5ebla1, d5ebla2, d5ebla3, d5eblb1, d5eblb2
    automated match to d1s5hc_
    complexed with dga, f09, k

Details for d5eblc_

PDB Entry: 5ebl (more details), 2.3 Å

PDB Description: kcsa t75g in the conductive state
PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d5eblc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eblc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetatgvgygdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d5eblc_:

Click to download the PDB-style file with coordinates for d5eblc_.
(The format of our PDB-style files is described here.)

Timeline for d5eblc_: