Lineage for d5d65e_ (5d65 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929310Protein automated matches [190403] (4 species)
    not a true protein
  7. 2929318Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)
  8. 2929372Domain d5d65e_: 5d65 E: [316054]
    automated match to d4ra8b_
    complexed with bgc, cl, glc

Details for d5d65e_

PDB Entry: 5d65 (more details), 3.1 Å

PDB Description: x-ray structure of macrophage inflammatory protein-1 alpha (ccl3) with heparin complex
PDB Compounds: (E:) C-C motif chemokine 3

SCOPe Domain Sequences for d5d65e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d65e_ d.9.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
kyvsdlels

SCOPe Domain Coordinates for d5d65e_:

Click to download the PDB-style file with coordinates for d5d65e_.
(The format of our PDB-style files is described here.)

Timeline for d5d65e_: