Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries) |
Domain d5d65b_: 5d65 B: [316053] automated match to d4ra8b_ complexed with bgc, cl, glc, ids, sgn |
PDB Entry: 5d65 (more details), 3.1 Å
SCOPe Domain Sequences for d5d65b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d65b_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky vsdlels
Timeline for d5d65b_:
View in 3D Domains from other chains: (mouse over for more information) d5d65a_, d5d65c_, d5d65d_, d5d65e_ |