SCOPe 2.06: Domain d5cgpa_: 5cgp A:

Lineage for d5cgpa_ (5cgp A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)

8. Domain d5cgpa_: 5cgp A: [316052]
   automated match to d4nyxa_
   complexed with 53w

Details for d5cgpa_

PDB Entry: 5cgp, 1.96 Å

PDB Description: selective pharmacological inhibition of the creb binding protein bromodomain regulates inflammatory cytokines in macrophages and rgs4 in neurons

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5cgpa_:

Sequence; same for both SEQRES and ATOM records:

>d5cgpa_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d5cgpa_:

• d5cgpa_ is new in SCOPe 2.06-stable
  
• d5cgpa_ appears in SCOPe 2.07
  
• d5cgpa_ appears in the current release, SCOPe 2.08