Lineage for d5cgpa_ (5cgp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706696Protein CREB-binding protein, CBP [74712] (2 species)
  7. 2706697Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)
  8. 2706773Domain d5cgpa_: 5cgp A: [316052]
    automated match to d4nyxa_
    complexed with 53w

Details for d5cgpa_

PDB Entry: 5cgp (more details), 1.96 Å

PDB Description: selective pharmacological inhibition of the creb binding protein bromodomain regulates inflammatory cytokines in macrophages and rgs4 in neurons
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5cgpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cgpa_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d5cgpa_:

Click to download the PDB-style file with coordinates for d5cgpa_.
(The format of our PDB-style files is described here.)

Timeline for d5cgpa_: