SCOP 1.69: Domain d1b6tb_: 1b6t B:

Lineage for d1b6tb_ (1b6t B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (5 proteins)

6. Protein Phosphopantetheine adenylyltransferase [52398] (5 species)

7. Species Escherichia coli [TaxId:562] [52399] (4 PDB entries)

8. Domain d1b6tb_: 1b6t B: [31601]

Details for d1b6tb_

PDB Entry: 1b6t, 1.8 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with 3'-dephospho-coa from escherichia coli

SCOP Domain Sequences for d1b6tb_:

Sequence; same for both SEQRES and ATOM records:

>d1b6tb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

Timeline for d1b6tb_:

• d1b6tb_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6tb_ appears in SCOP 1.67
  
• d1b6tb_ appears in SCOP 1.71
  
• d1b6tb_ appears in the current release, SCOPe 2.08