Lineage for d1b6tb_ (1b6t B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) 
Family c.26.1.3: Adenylyltransferase [52397] (2 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (1 species) Species Escherichia coli [TaxId:562] [52399] (1 PDB entry) 
Domain d1b6tb_: 1b6t B: [31601]
Details for d1b6tb_
PDB Entry: 1b6t (more details), 1.8 Å
PDB Description: phosphopantetheine adenylyltransferase in complex with 3'-dephospho-coa from escherichia coli
SCOP Domain Sequences for d1b6tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6tb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla
SCOP Domain Coordinates for d1b6tb_:
Click to download the PDB-style file with coordinates for d1b6tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b6tb_:
- d1b6tb_ appears in SCOP 1.57
- d1b6tb_ appears in the current release, SCOPe 2.08
View in 3D
