Lineage for d1cozb_ (1coz B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22501Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 22502Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) (S)
  5. 22556Family c.26.1.2: Cytidylyltransferase [52394] (1 protein)
  6. 22557Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species)
  7. 22558Species Bacillus subtilis [TaxId:1423] [52396] (1 PDB entry)
  8. 22560Domain d1cozb_: 1coz B: [31599]

Details for d1cozb_

PDB Entry: 1coz (more details), 2 Å

PDB Description: ctp:glycerol-3-phosphate cytidylyltransferase from bacillus subtilis

SCOP Domain Sequences for d1cozb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cozb_ c.26.1.2 (B:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei

SCOP Domain Coordinates for d1cozb_:

Click to download the PDB-style file with coordinates for d1cozb_.
(The format of our PDB-style files is described here.)

Timeline for d1cozb_: