Lineage for d1bs2a2 (1bs2 A:136-483)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242044Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (11 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 242045Protein Arginyl-tRNA synthetase (ArgRS) [52392] (2 species)
  7. 242046Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52393] (3 PDB entries)
  8. 242048Domain d1bs2a2: 1bs2 A:136-483 [31597]
    Other proteins in same PDB: d1bs2a1, d1bs2a3

Details for d1bs2a2

PDB Entry: 1bs2 (more details), 2.75 Å

PDB Description: yeast arginyl-trna synthetase

SCOP Domain Sequences for d1bs2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bs2a2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae)}
scklvenkkviiefsspniakpfhaghlrstiiggflanlyeklgwevirmnylgdwgkq
fgllavgferygneealvkdpihhlfdvyvrinkdieeegdsipleqstngkareyfkrm
edgdeealkiwkrfrefsiekyidtyarlnikydvysgesqvskesmlkaidlfkekglt
hedkgavlidltkfnkklgkaivqksdgttlyltrdvgaamdryekyhfdkmiyviasqq
dlhaaqffeilkqmgfewakdlqhvnfgmvqgmstrkgtvvfldnileetkekmhevmkk
nenkyaqiehpeevadlvgisavmiqdmqgkrinnyefkwermlsfeg

SCOP Domain Coordinates for d1bs2a2:

Click to download the PDB-style file with coordinates for d1bs2a2.
(The format of our PDB-style files is described here.)

Timeline for d1bs2a2: