Lineage for d1qu3a3 (1qu3 A:2-200,A:395-644)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1160660Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1160722Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species)
  7. 1160723Species Staphylococcus aureus [TaxId:1280] [52389] (3 PDB entries)
  8. 1160726Domain d1qu3a3: 1qu3 A:2-200,A:395-644 [31594]
    Other proteins in same PDB: d1qu3a1, d1qu3a2
    protein/RNA complex; complexed with mrc, zn

Details for d1qu3a3

PDB Entry: 1qu3 (more details), 2.9 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1qu3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu3a3 c.26.1.1 (A:2-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
dyektllmpktdfpmrgglpnkepqiqekwdaedqyhkaleknkgnetfilhdgppyang
nlhmghalnkilkdfivryktmqgfyapyvpgwdthglpieqaltkkgvdrkkmstaefr
ekckefaleqielqkkdfrrlgvrgdfndpyitlkpeyeaaqirifgemadkgliykgkk
pvywspssesslaeaeieyXphdwrtkkpvifratpqwfasiskvrqdildaientnfkv
nwgktriynmvrdrgewvisrqrvwgvplpvfyaengeiimtketvnhvadlfaehgsni
wfereakdllpegfthpgspngtftketdimdvwfdsgsshrgvletrpelsfpadmyle
gsdqyrgwfnssittsvatrgvspykfllshgfvmdgegkkmskslgnvivpdqvvkqkg
adiarlwvsstdyladvrisdeilkqtsdd

SCOPe Domain Coordinates for d1qu3a3:

Click to download the PDB-style file with coordinates for d1qu3a3.
(The format of our PDB-style files is described here.)

Timeline for d1qu3a3: