Lineage for d1ffya3 (1ffy A:1-200,A:395-644)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827434Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 827435Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 827497Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species)
  7. 827498Species Staphylococcus aureus [TaxId:1280] [52389] (3 PDB entries)
  8. 827499Domain d1ffya3: 1ffy A:1-200,A:395-644 [31593]
    Other proteins in same PDB: d1ffya1, d1ffya2
    protein/RNA complex; complexed with k, mo2, mo4, mo5, mo6, mrc, zn

Details for d1ffya3

PDB Entry: 1ffy (more details), 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOP Domain Sequences for d1ffya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]}
mdyektllmpktdfpmrgglpnkepqiqekwdaedqyhkaleknkgnetfilhdgppyan
gnlhmghalnkilkdfivryktmqgfyapyvpgwdthglpieqaltkkgvdrkkmstaef
rekckefaleqielqkkdfrrlgvrgdfndpyitlkpeyeaaqirifgemadkgliykgk
kpvywspssesslaeaeieyXphdwrtkkpvifratpqwfasiskvrqdildaientnfk
vnwgktriynmvrdrgewvisrqrvwgvplpvfyaengeiimtketvnhvadlfaehgsn
iwfereakdllpegfthpgspngtftketdimdvwfdsgsshrgvletrpelsfpadmyl
egsdqyrgwfnssittsvatrgvspykfllshgfvmdgegkkmskslgnvivpdqvvkqk
gadiarlwvsstdyladvrisdeilkqtsdd

SCOP Domain Coordinates for d1ffya3:

Click to download the PDB-style file with coordinates for d1ffya3.
(The format of our PDB-style files is described here.)

Timeline for d1ffya3: