Lineage for d1qu2a3 (1qu2 A:1-200,A:395-644)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22501Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 22502Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) (S)
  5. 22503Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins)
  6. 22522Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species)
  7. 22523Species Staphylococcus aureus [TaxId:1280] [52389] (3 PDB entries)
  8. Domain d1qu2a3: 1qu2 A:1-200,A:395-644 [31592]
    Other proteins in same PDB: d1qu2a1, d1qu2a2

Details for d1qu2a3

PDB Entry: 1qu2 (more details), 2.2 Å

PDB Description: insights into editing from an ile-trna synthetase structure with trna(ile) and mupirocin

SCOP Domain Sequences for d1qu2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu2a3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus}
mdyektllmpktdfpmrgglpnkepqiqekwdaedqyhkaleknkgnetfilhdgppyan
gnlhmghalnkilkdfivryktmqgfyapyvpgwdthglpieqaltkkgvdrkkmstaef
rekckefaleqielqkkdfrrlgvrgdfndpyitlkpeyeaaqirifgemadkgliykgk
kpvywspssesslaeaeieyXphdwrtkkpvifratpqwfasiskvrqdildaientnfk
vnwgktriynmvrdrgewvisrqrvwgvplpvfyaengeiimtketvnhvadlfaehgsn
iwfereakdllpegfthpgspngtftketdimdvwfdsgsshrgvletrpelsfpadmyl
egsdqyrgwfnssittsvatrgvspykfllshgfvmdgegkkmskslgnvivpdqvvkqk
gadiarlwvsstdyladvrisdeilkqtsdd

SCOP Domain Coordinates for d1qu2a3 are not available.

Timeline for d1qu2a3:

Domains from same chain:
(mouse over for more information)
d1qu2a1, d1qu2a2