Lineage for d1a8h_2 (1a8h 1-348)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 579982Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 579983Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 580045Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. 580058Species Thermus thermophilus [TaxId:274] [52385] (1 PDB entry)
  8. 580059Domain d1a8h_2: 1a8h 1-348 [31589]
    Other proteins in same PDB: d1a8h_1
    complexed with zn

Details for d1a8h_2

PDB Entry: 1a8h (more details), 2 Å

PDB Description: methionyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1a8h_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8h_2 c.26.1.1 (1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

SCOP Domain Coordinates for d1a8h_2:

Click to download the PDB-style file with coordinates for d1a8h_2.
(The format of our PDB-style files is described here.)

Timeline for d1a8h_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8h_1