Lineage for d1a8h_2 (1a8h 1-348)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22501Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 22502Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) (S)
  5. 22503Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins)
  6. 22529Protein Methionyl-tRNA synthetase (MetR) [52384] (2 species)
  7. 22532Species Thermus thermophilus [TaxId:274] [52385] (1 PDB entry)
  8. 22533Domain d1a8h_2: 1a8h 1-348 [31589]
    Other proteins in same PDB: d1a8h_1

Details for d1a8h_2

PDB Entry: 1a8h (more details), 2 Å

PDB Description: methionyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1a8h_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8h_2 c.26.1.1 (1-348) Methionyl-tRNA synthetase (MetR) {Thermus thermophilus}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

SCOP Domain Coordinates for d1a8h_2:

Click to download the PDB-style file with coordinates for d1a8h_2.
(The format of our PDB-style files is described here.)

Timeline for d1a8h_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8h_1