Lineage for d1exda2 (1exd A:8-338)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins) 
Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (1 species) Species Escherichia coli [TaxId:562] [52381] (10 PDB entries) 
Domain d1exda2: 1exd A:8-338 [31583]
Other proteins in same PDB: d1exda1
Details for d1exda2
PDB Entry: 1exd (more details), 2.7 Å
PDB Description: crystal structure of a tight-binding glutamine trna bound to glutamine aminoacyl trna synthetase
SCOP Domain Sequences for d1exda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exda2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen
SCOP Domain Coordinates for d1exda2:
Click to download the PDB-style file with coordinates for d1exda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exda2:
- d1exda2 appears in SCOP 1.57
- d1exda2 appears in the current release, SCOPe 2.08
View in 3D
