Lineage for d1qrta2 (1qrt A:8-338)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841372Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (2 species)
  7. 1841375Species Escherichia coli [TaxId:562] [52381] (17 PDB entries)
  8. 1841381Domain d1qrta2: 1qrt A:8-338 [31582]
    Other proteins in same PDB: d1qrta1
    protein/RNA complex; complexed with atp; mutant

Details for d1qrta2

PDB Entry: 1qrt (more details), 2.7 Å

PDB Description: glutaminyl-trna synthetase mutant d235g complexed with glutamine transfer rna
PDB Compounds: (A:) protein (glutaminyl-tRNA synthetase (e.c.6.1.1.18))

SCOPe Domain Sequences for d1qrta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrta2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqgnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen

SCOPe Domain Coordinates for d1qrta2:

Click to download the PDB-style file with coordinates for d1qrta2.
(The format of our PDB-style files is described here.)

Timeline for d1qrta2: