Lineage for d1gtsa2 (1gts A:8-338)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68936Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 68937Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 68938Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins)
  6. 68944Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (1 species)
  7. 68945Species Escherichia coli [TaxId:562] [52381] (10 PDB entries)
  8. 68949Domain d1gtsa2: 1gts A:8-338 [31581]
    Other proteins in same PDB: d1gtsa1

Details for d1gtsa2

PDB Entry: 1gts (more details), 2.8 Å

PDB Description: structural basis for transfer rna aminoaceylation by escherichia coli glutaminyl-trna synthetase

SCOP Domain Sequences for d1gtsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtsa2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen

SCOP Domain Coordinates for d1gtsa2:

Click to download the PDB-style file with coordinates for d1gtsa2.
(The format of our PDB-style files is described here.)

Timeline for d1gtsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gtsa1