Lineage for d1qtqa2 (1qtq A:8-338)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22501Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 22502Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) (S)
  5. 22503Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins)
  6. 22507Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (1 species)
  7. 22508Species Escherichia coli [TaxId:562] [52381] (10 PDB entries)
  8. 22511Domain d1qtqa2: 1qtq A:8-338 [31579]
    Other proteins in same PDB: d1qtqa1

Details for d1qtqa2

PDB Entry: 1qtq (more details), 2.4 Å

PDB Description: glutaminyl-trna synthetase complexed with trna and an amino acid analog

SCOP Domain Sequences for d1qtqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtqa2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen

SCOP Domain Coordinates for d1qtqa2:

Click to download the PDB-style file with coordinates for d1qtqa2.
(The format of our PDB-style files is described here.)

Timeline for d1qtqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qtqa1