Lineage for d1qtqa2 (1qtq A:8-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860065Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (2 species)
  7. 2860068Species Escherichia coli [TaxId:562] [52381] (17 PDB entries)
  8. 2860069Domain d1qtqa2: 1qtq A:8-338 [31579]
    Other proteins in same PDB: d1qtqa1
    protein/RNA complex; complexed with qsi, so4

Details for d1qtqa2

PDB Entry: 1qtq (more details), 2.25 Å

PDB Description: glutaminyl-trna synthetase complexed with trna and an amino acid analog
PDB Compounds: (A:) protein (glutaminyl-tRNA synthetase)

SCOPe Domain Sequences for d1qtqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtqa2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen

SCOPe Domain Coordinates for d1qtqa2:

Click to download the PDB-style file with coordinates for d1qtqa2.
(The format of our PDB-style files is described here.)

Timeline for d1qtqa2: