Lineage for d1d2re_ (1d2r E:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68936Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 68937Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 68938Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins)
  6. 68974Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (1 species)
  7. 68975Species Bacillus stearothermophilus [TaxId:1422] [52379] (1 PDB entry)
  8. 68980Domain d1d2re_: 1d2r E: [31576]

Details for d1d2re_

PDB Entry: 1d2r (more details), 2.9 Å

PDB Description: 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site.

SCOP Domain Sequences for d1d2re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2re_ c.26.1.1 (E:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOP Domain Coordinates for d1d2re_:

Click to download the PDB-style file with coordinates for d1d2re_.
(The format of our PDB-style files is described here.)

Timeline for d1d2re_: