Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (3 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (8 proteins) |
Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [52379] (1 PDB entry) |
Domain d1d2rd_: 1d2r D: [31575] |
PDB Entry: 1d2r (more details), 2.9 Å
SCOP Domain Sequences for d1d2rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2rd_ c.26.1.1 (D:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus} mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl degaekanrvasemvrkmeqamglgr
Timeline for d1d2rd_: