SCOPe 2.05: Domain d1d2rb_: 1d2r B:

Lineage for d1d2rb_ (1d2r B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
   overall structure is similar to TyrRS

7. Species Bacillus stearothermophilus [TaxId:1422] [52379] (12 PDB entries)

8. Domain d1d2rb_: 1d2r B: [31573]

Details for d1d2rb_

PDB Entry: 1d2r, 2.9 Å

PDB Description: 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site.

PDB Compounds: (B:) protein (tryptophanyl tRNA synthetase)

SCOPe Domain Sequences for d1d2rb_:

Sequence; same for both SEQRES and ATOM records:

>d1d2rb_ c.26.1.1 (B:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

Timeline for d1d2rb_:

• d1d2rb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2rb_ appears in SCOPe 2.04
  
• d1d2rb_ appears in SCOPe 2.06
  
• d1d2rb_ appears in the current release, SCOPe 2.08