Lineage for d1d2ra_ (1d2r A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841446Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 1841447Species Bacillus stearothermophilus [TaxId:1422] [52379] (12 PDB entries)
  8. 1841485Domain d1d2ra_: 1d2r A: [31572]

Details for d1d2ra_

PDB Entry: 1d2r (more details), 2.9 Å

PDB Description: 2.9 a crystal structure of ligand-free tryptophanyl-trna synthetase: domain movements fragment the adenine nucleotide binding site.
PDB Compounds: (A:) protein (tryptophanyl tRNA synthetase)

SCOPe Domain Sequences for d1d2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ra_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagaaaaaa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgr

SCOPe Domain Coordinates for d1d2ra_:

Click to download the PDB-style file with coordinates for d1d2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ra_: