Lineage for d4ts1b_ (4ts1 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105558Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2105559Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [52377] (7 PDB entries)
  8. 2105561Domain d4ts1b_: 4ts1 B: [31566]
    protein/RNA complex; complexed with tyr; mutant

Details for d4ts1b_

PDB Entry: 4ts1 (more details), 2.5 Å

PDB Description: crystal structure of a deletion mutant of a tyrosyl-t/rna synthetase complexed with tyrosine
PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d4ts1b_:

Sequence, based on SEQRES records: (download)

>d4ts1b_ c.26.1.1 (B:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
mdllaelqwrglvnqttdedglrkllneervtlycgfdptadslhighlatiltmrrfqq
aghrpialvggatgligdpsgkksertlnaketveawsarikeqlgrfldfeadgnpaki
knnydwigpldvitflrdvgkhfsvnymmakesvqsrietgisftefsymmlqaydflrl
yetegcrlqiggsdqwgnitaglelirktkgearafgltiplvtkadgtkfgktesgtiw
ldkektspyefyqfwintddrdvirylkyftflskeeiealeqelreapekraaqktlae
evtklvhgeealr

Sequence, based on observed residues (ATOM records): (download)

>d4ts1b_ c.26.1.1 (B:) Tyrosyl-tRNA synthetase (TyrRS) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
mdllaelqwrglvnqttdedglrkllneervtlycgfdptadslhighlatiltmrrfqq
aghrpialvggatgligdpsgkksertlnaketveawsarikeqlgrfldfeadgnpaki
knnydwigpldvitflrdvgkhfsvnymmakesvqsrietgisftefsymmlqaydflrl
yetegcrlqiggsdqwgnitaglelirktkgrafgltiplvtkadgtkfgktesgtiwld
kektspyefyqfwintddrdvirylkyftflskeeiealeqelreapekraaqktlaeev
tklvhgeealr

SCOPe Domain Coordinates for d4ts1b_:

Click to download the PDB-style file with coordinates for d4ts1b_.
(The format of our PDB-style files is described here.)

Timeline for d4ts1b_: