Lineage for d4z42e_ (4z42 E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406745Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. 2406801Family b.85.3.0: automated matches [315534] (1 protein)
    not a true family
  6. 2406802Protein automated matches [315535] (1 species)
    not a true protein
  7. 2406803Species Yersinia enterocolitica [TaxId:913028] [315536] (1 PDB entry)
  8. 2406805Domain d4z42e_: 4z42 E: [315631]
    Other proteins in same PDB: d4z42a_, d4z42d_, d4z42g_, d4z42j_
    automated match to d4ubpb_
    complexed with ni

Details for d4z42e_

PDB Entry: 4z42 (more details), 3.01 Å

PDB Description: crystal structure of urease from yersinia enterocolitica
PDB Compounds: (E:) urease subunit beta

SCOPe Domain Sequences for d4z42e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z42e_ b.85.3.0 (E:) automated matches {Yersinia enterocolitica [TaxId: 913028]}
ntplggciladtpitfnenkpvtkvkvrntgdrpiqvgshfhffevnralefdraaaygk
rlnissttairfepgdetevplipfggkqtlygfnnlvdgwtgegvvpnserpd

SCOPe Domain Coordinates for d4z42e_:

Click to download the PDB-style file with coordinates for d4z42e_.
(The format of our PDB-style files is described here.)

Timeline for d4z42e_: