Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein) contains additional globin domain automatically mapped to Pfam PF00175 |
Protein Flavohemoglobin, C-terminal domain [52371] (2 species) |
Species Alcaligenes eutrophus [TaxId:106590] [52372] (1 PDB entry) |
Domain d1cqxb3: 1cqx B:262-403 [31563] Other proteins in same PDB: d1cqxa1, d1cqxa2, d1cqxb1, d1cqxb2 complexed with dgg, fad, hem, na |
PDB Entry: 1cqx (more details), 1.75 Å
SCOPe Domain Sequences for d1cqxb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqxb3 c.25.1.5 (B:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal knlgihearihyevfgpdlfae
Timeline for d1cqxb3: