| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein) contains additional globin domain automatically mapped to Pfam PF00175 |
| Protein Flavohemoglobin, C-terminal domain [52371] (2 species) |
| Species Alcaligenes eutrophus [TaxId:106590] [52372] (1 PDB entry) |
| Domain d1cqxa3: 1cqx A:262-403 [31562] Other proteins in same PDB: d1cqxa1, d1cqxa2, d1cqxb1, d1cqxb2 complexed with dgg, fad, hem, na |
PDB Entry: 1cqx (more details), 1.75 Å
SCOPe Domain Sequences for d1cqxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae
Timeline for d1cqxa3: