Lineage for d1cqxa3 (1cqx A:262-403)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120976Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 120977Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 121071Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein)
  6. 121072Protein Flavohemoglobin, C-terminal domain [52371] (1 species)
  7. 121073Species Alcaligenes eutrophus [TaxId:106590] [52372] (1 PDB entry)
  8. 121074Domain d1cqxa3: 1cqx A:262-403 [31562]
    Other proteins in same PDB: d1cqxa1, d1cqxa2, d1cqxb1, d1cqxb2

Details for d1cqxa3

PDB Entry: 1cqx (more details), 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution

SCOP Domain Sequences for d1cqxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae

SCOP Domain Coordinates for d1cqxa3:

Click to download the PDB-style file with coordinates for d1cqxa3.
(The format of our PDB-style files is described here.)

Timeline for d1cqxa3: