![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) ![]() |
![]() | Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein) |
![]() | Protein Flavohemoglobin, C-terminal domain [52371] (1 species) |
![]() | Species Alcaligenes eutrophus [TaxId:106590] [52372] (1 PDB entry) |
![]() | Domain d1cqxa3: 1cqx A:262-403 [31562] Other proteins in same PDB: d1cqxa1, d1cqxa2, d1cqxb1, d1cqxb2 |
PDB Entry: 1cqx (more details), 1.75 Å
SCOP Domain Sequences for d1cqxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus} dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal knlgihearihyevfgpdlfae
Timeline for d1cqxa3: