Lineage for d5i30l2 (5i30 L:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752478Domain d5i30l2: 5i30 L:108-212 [315615]
    Other proteins in same PDB: d5i30h_, d5i30l1
    automated match to d1h3pl2
    complexed with nag

Details for d5i30l2

PDB Entry: 5i30 (more details), 1.9 Å

PDB Description: crystal structure of the human astrovirus 2 neutralizing monoclonal antibody pl-2 fab fragment at 1.9 a resolution
PDB Compounds: (L:) Fab PL-2 light chain

SCOPe Domain Sequences for d5i30l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i30l2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5i30l2:

Click to download the PDB-style file with coordinates for d5i30l2.
(The format of our PDB-style files is described here.)

Timeline for d5i30l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i30l1
View in 3D
Domains from other chains:
(mouse over for more information)
d5i30h_