Lineage for d4z3jc_ (4z3j C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767730Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (2 proteins)
    automatically mapped to Pfam PF03627
  6. 2767735Protein automated matches [315530] (1 species)
    not a true protein
  7. 2767736Species Escherichia coli [TaxId:562] [315531] (6 PDB entries)
  8. 2767745Domain d4z3jc_: 4z3j C: [315612]
    automated match to d1j8ra_

Details for d4z3jc_

PDB Entry: 4z3j (more details), 2.5 Å

PDB Description: crystal structure of the lectin domain of papg from e. coli bi47 in space group p1
PDB Compounds: (C:) PapG, lectin domain

SCOPe Domain Sequences for d4z3jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z3jc_ b.2.3.3 (C:) automated matches {Escherichia coli [TaxId: 562]}
awnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgswayyre
yiawvvfpkkvmtkngyplfievhnkgswseentgdndsyfflkgykwdqrafdtanlcq
kpgettrltekfddiifkvalpadlplgdysvtipytsgiqrhfasylgarfkipynvak
tlprenemlflfknig

SCOPe Domain Coordinates for d4z3jc_:

Click to download the PDB-style file with coordinates for d4z3jc_.
(The format of our PDB-style files is described here.)

Timeline for d4z3jc_: