| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.3: PapG adhesin receptor-binding domain [63680] (2 proteins) automatically mapped to Pfam PF03627 |
| Protein automated matches [315530] (1 species) not a true protein |
| Species Escherichia coli [TaxId:562] [315531] (6 PDB entries) |
| Domain d4z3jc_: 4z3j C: [315612] automated match to d1j8ra_ |
PDB Entry: 4z3j (more details), 2.5 Å
SCOPe Domain Sequences for d4z3jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z3jc_ b.2.3.3 (C:) automated matches {Escherichia coli [TaxId: 562]}
awnnivfyslgdvnsyqggnvvitqrpqfitswrpgiatvtwnqcngpefadgswayyre
yiawvvfpkkvmtkngyplfievhnkgswseentgdndsyfflkgykwdqrafdtanlcq
kpgettrltekfddiifkvalpadlplgdysvtipytsgiqrhfasylgarfkipynvak
tlprenemlflfknig
Timeline for d4z3jc_: