Lineage for d4yyaa_ (4yya A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776806Species Unidentified influenza virus [TaxId:119212] [312272] (6 PDB entries)
  8. 2776807Domain d4yyaa_: 4yya A: [315599]
    Other proteins in same PDB: d4yyab_
    automated match to d4xkgc_
    complexed with nag

Details for d4yyaa_

PDB Entry: 4yya (more details), 2.6 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013) in complex with avian receptor analog 3'slnln
PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d4yyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyaa_ b.19.1.0 (A:) automated matches {Unidentified influenza virus [TaxId: 119212]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvpq

SCOPe Domain Coordinates for d4yyaa_:

Click to download the PDB-style file with coordinates for d4yyaa_.
(The format of our PDB-style files is described here.)

Timeline for d4yyaa_: