SCOPe 2.08: Domain d4yyaa_: 4yya A:

Lineage for d4yyaa_ (4yya A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Unidentified influenza virus [TaxId:119212] [312272] (6 PDB entries)

8. Domain d4yyaa_: 4yya A: [315599]
   Other proteins in same PDB: d4yyab_
   automated match to d4xkgc_
   complexed with nag

Details for d4yyaa_

PDB Entry: 4yya, 2.6 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013) in complex with avian receptor analog 3'slnln

PDB Compounds: (A:) ha1

SCOPe Domain Sequences for d4yyaa_:

Sequence; same for both SEQRES and ATOM records:

>d4yyaa_ b.19.1.0 (A:) automated matches {Unidentified influenza virus [TaxId: 119212]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvpq

Timeline for d4yyaa_:

• d4yyaa_ first appeared in SCOPe 2.06
  
• d4yyaa_ appears in SCOPe 2.07