SCOPe 2.08: Domain d5f9wl2: 5f9w L:107-211

Lineage for d5f9wl2 (5f9w L:107-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5f9wl2: 5f9w L:107-211 [315598]
   Other proteins in same PDB: d5f9wb_, d5f9wc1, d5f9wh_, d5f9wl1
   automated match to d1dn0a2
   complexed with nag, po4

Details for d5f9wl2

PDB Entry: 5f9w, 2.89 Å

PDB Description: crystal structure of broadly neutralizing vh1-46 germline-derived cd4- binding site-directed antibody ch235 in complex with hiv-1 clade a/e 93th057 gp120

PDB Compounds: (L:) Light chain of CH235-lineage antibody CH235

SCOPe Domain Sequences for d5f9wl2:

Sequence; same for both SEQRES and ATOM records:

>d5f9wl2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5f9wl2:

• d5f9wl2 first appeared in SCOPe 2.06
  
• d5f9wl2 appears in SCOPe 2.07