Lineage for d4yyqa_ (4yyq A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534811Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2534812Protein automated matches [190230] (23 species)
    not a true protein
  7. 2534855Species Ficus carica [TaxId:3494] [315499] (5 PDB entries)
  8. 2534859Domain d4yyqa_: 4yyq A: [315591]
    automated match to d1cqda_

Details for d4yyqa_

PDB Entry: 4yyq (more details), 1.59 Å

PDB Description: ficin a
PDB Compounds: (A:) Ficin isoform A

SCOPe Domain Sequences for d4yyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyqa_ d.3.1.0 (A:) automated matches {Ficus carica [TaxId: 3494]}
lpetvdwrskgavnpirnqgqcgscwafsavaavesinkivtgqllslseqqlldcaqsy
knlgcqggwvnkafeyiiqnrgitsqsnypytghkgqcrtglasiatidsyqyvpsnnen
alknavanqpvsvaveaagrafqlyksgvftgscgvaidhavvligygkyngvdywllrn
swgtnwgeqgymklqrnvaqsagkcgvarlclypvk

SCOPe Domain Coordinates for d4yyqa_:

Click to download the PDB-style file with coordinates for d4yyqa_.
(The format of our PDB-style files is described here.)

Timeline for d4yyqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4yyqb_