SCOPe 2.07: Domain d4yyqa_: 4yyq A:

Lineage for d4yyqa_ (4yyq A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Ficus carica [TaxId:3494] [315499] (5 PDB entries)

8. Domain d4yyqa_: 4yyq A: [315591]
   automated match to d1cqda_

Details for d4yyqa_

PDB Entry: 4yyq, 1.59 Å

PDB Description: ficin a

PDB Compounds: (A:) Ficin isoform A

SCOPe Domain Sequences for d4yyqa_:

Sequence; same for both SEQRES and ATOM records:

>d4yyqa_ d.3.1.0 (A:) automated matches {Ficus carica [TaxId: 3494]}
lpetvdwrskgavnpirnqgqcgscwafsavaavesinkivtgqllslseqqlldcaqsy
knlgcqggwvnkafeyiiqnrgitsqsnypytghkgqcrtglasiatidsyqyvpsnnen
alknavanqpvsvaveaagrafqlyksgvftgscgvaidhavvligygkyngvdywllrn
swgtnwgeqgymklqrnvaqsagkcgvarlclypvk

Timeline for d4yyqa_:

• d4yyqa_ first appeared in SCOPe 2.06
  
• d4yyqa_ appears in the current release, SCOPe 2.08