SCOPe 2.06: Domain d4z7ea_: 4z7e A:

Lineage for d4z7ea_ (4z7e A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries)

8. Domain d4z7ea_: 4z7e A: [315586]
   automated match to d1sw5a_
   complexed with 1pe, peg, ppi

Details for d4z7ea_

PDB Entry: 4z7e, 1.5 Å

PDB Description: soluble binding domain of lmo1422 abc-transporter

PDB Compounds: (A:) Lmo1422 protein

SCOPe Domain Sequences for d4z7ea_:

Sequence; same for both SEQRES and ATOM records:

>d4z7ea_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
eitiagklgaepeilinmyklviedetdlkvnvkpnmgktsfvfnalksgdidiypeftg
tvletflkenakthdpeevytqardglakdfdmtylkpmkynntyalavspefakennle
kisdlgpvsdqvkagftlefkdrsdgykgiqdkygltfsnlktmepklrynaiksgdinl
ldaystdselaqyklkvleddqqlfppyqgaplmltktldkypelkkplnklagkitdde
mrkmnyevnvngksaytvakdylkdqgiik

Timeline for d4z7ea_:

• d4z7ea_ is new in SCOPe 2.06-stable
  
• d4z7ea_ appears in SCOPe 2.07
  
• d4z7ea_ appears in the current release, SCOPe 2.08