| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries) |
| Domain d4z7ea_: 4z7e A: [315586] automated match to d1sw5a_ complexed with 1pe, peg, ppi |
PDB Entry: 4z7e (more details), 1.5 Å
SCOPe Domain Sequences for d4z7ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7ea_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}
eitiagklgaepeilinmyklviedetdlkvnvkpnmgktsfvfnalksgdidiypeftg
tvletflkenakthdpeevytqardglakdfdmtylkpmkynntyalavspefakennle
kisdlgpvsdqvkagftlefkdrsdgykgiqdkygltfsnlktmepklrynaiksgdinl
ldaystdselaqyklkvleddqqlfppyqgaplmltktldkypelkkplnklagkitdde
mrkmnyevnvngksaytvakdylkdqgiik
Timeline for d4z7ea_: