SCOPe 2.08: Domain d5corh_: 5cor H:

Lineage for d5corh_ (5cor H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein automated matches [190403] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)

8. Domain d5corh_: 5cor H: [315571]
   automated match to d4ra8b_
   complexed with act, hez

Details for d5corh_

PDB Entry: 5cor, 2.55 Å

PDB Description: x-ray structure of macrophage inflammatory protein-1 alpha (ccl3) n- terminal-switch polymer

PDB Compounds: (H:) C-C motif chemokine 3

SCOPe Domain Sequences for d5corh_:

Sequence; same for both SEQRES and ATOM records:

>d5corh_ d.9.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
vsdlelsa

Timeline for d5corh_:

• d5corh_ first appeared in SCOPe 2.06
  
• d5corh_ appears in SCOPe 2.07