Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
Protein automated matches [190170] (17 species) not a true protein |
Species Dictyostelium purpureum [TaxId:5786] [315557] (1 PDB entry) |
Domain d4zzpa_: 4zzp A: [315561] automated match to d2y9na_ complexed with nag |
PDB Entry: 4zzp (more details), 2.7 Å
SCOPe Domain Sequences for d4zzpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zzpa_ b.29.1.10 (A:) automated matches {Dictyostelium purpureum [TaxId: 5786]} ekvgkfspevhppitwqecaddgscktmngeividanwrwvhseqgtncytgntwnptlc pddktcaencyldganyesvygitteddsvrlnfitqsqgknigsrtflmanstnyqmfy vlgqefsfdvdvsnldcglngalylvsmdsdggiarfpsneagaqygtgycdaqcprdlk fisgsanvegwipssnnpntgygnhgsccaemdlweannmataltphpcdtssqtvcesd scggatssnrygglcdpdgcdynpyrmgnttffgpgqtvdtksvmtvvtqfitndgtttg tlksikrlyvqngqvisqsestvpgvagneitedfchnqkqvfgdkdsftkhgglaamgd alkngmvlvlslwddyladmlwldsnypttspvtepgvargpcstssgtptdveskypna yvvysnikvgpinstfk
Timeline for d4zzpa_: