Lineage for d1ep2b2 (1ep2 B:103-262)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178377Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 178378Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 178452Family c.25.1.3: Dihydroorotate dehydrogenase B, PyrK subunit [52362] (1 protein)
  6. 178453Protein Dihydroorotate dehydrogenase B, PyrK subunit [52363] (1 species)
  7. 178454Species Lactococcus lactis, isozyme B [TaxId:1358] [52364] (3 PDB entries)
  8. 178457Domain d1ep2b2: 1ep2 B:103-262 [31556]
    Other proteins in same PDB: d1ep2a_, d1ep2b1

Details for d1ep2b2

PDB Entry: 1ep2 (more details), 2.4 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate

SCOP Domain Sequences for d1ep2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep2b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B}
pvaevtstdkiliigggigvpplyelakqlektgcqmtillgfasenvkilenefsnlkn
vtlkiatddgsygtkghvgmlmneidfevdalytcgapamlkavakkydqlerlyismes
rmacgigacyacvehdkedeshalkvcedgpvflgkqlsl

SCOP Domain Coordinates for d1ep2b2:

Click to download the PDB-style file with coordinates for d1ep2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ep2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ep2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ep2a_