Lineage for d4yyab_ (4yya B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041158Domain d4yyab_: 4yya B: [315553]
    Other proteins in same PDB: d4yyaa_
    automated match to d5br0b_
    complexed with nag

Details for d4yyab_

PDB Entry: 4yya (more details), 2.6 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/taiwan/2/2013) in complex with avian receptor analog 3'slnln
PDB Compounds: (B:) ha2

SCOPe Domain Sequences for d4yyab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyab_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq

SCOPe Domain Coordinates for d4yyab_:

Click to download the PDB-style file with coordinates for d4yyab_.
(The format of our PDB-style files is described here.)

Timeline for d4yyab_: