Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) |
Family d.8.1.0: automated matches [193589] (1 protein) not a true family |
Protein automated matches [193590] (3 species) not a true protein |
Species Yersinia enterocolitica [TaxId:913028] [315538] (1 PDB entry) |
Domain d4z42d_: 4z42 D: [315550] Other proteins in same PDB: d4z42b_, d4z42e_, d4z42h_, d4z42k_ automated match to d4fura_ complexed with ni |
PDB Entry: 4z42 (more details), 3.01 Å
SCOPe Domain Sequences for d4z42d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z42d_ d.8.1.0 (D:) automated matches {Yersinia enterocolitica [TaxId: 913028]} mqltpreveklmiytlsdvafkrkarglklnypeavsiitvtamegardgksvedvmkea skvltkddvmdgvadlipnvqveaiftdgsrlvtvhdpi
Timeline for d4z42d_: